Lineage for d3a0gb_ (3a0g B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978856Species Guinea pig (Cavia porcellus) [TaxId:10141] [189281] (2 PDB entries)
  8. 1978860Domain d3a0gb_: 3a0g B: [171631]
    automated match to d1fhjb_
    complexed with hem, oxy

Details for d3a0gb_

PDB Entry: 3a0g (more details), 2.5 Å

PDB Description: crystal structure analysis of guinea pig oxyhemoglobin at 2.5 angstroms resolution
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3a0gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0gb_ a.1.1.2 (B:) automated matches {Guinea pig (Cavia porcellus) [TaxId: 10141]}
vhltaaeksaildlwgkvnvgeigaealgrllvvypwtqrffekfgdlssasaimsnahv
kshgakvlasfseglkhlqdlkgtfaklselhcdklhvdpenfrllgnmltiaiahhhps
eftpctqaafqkvtagvanalahk

SCOPe Domain Coordinates for d3a0gb_:

Click to download the PDB-style file with coordinates for d3a0gb_.
(The format of our PDB-style files is described here.)

Timeline for d3a0gb_: