![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins) Pfam PF00685 similar to the nucleotide/nucleoside kinases but transfer sulphate group |
![]() | Protein automated matches [190189] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188670] (8 PDB entries) |
![]() | Domain d2zytx_: 2zyt X: [171608] automated match to d1ls6a_ complexed with gol, pps |
PDB Entry: 2zyt (more details), 1.55 Å
SCOPe Domain Sequences for d2zytx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zytx_ c.37.1.5 (X:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kldvfrrelvdvegiplfwsiaehwsqvesfearpddilistypksgttwvseildliyn ngdaekckrdaiykrvpfmeliipgitngvemlnnmpsprivkthlpvqllpssfwkndc kiiyvarnakdvvvsyyyfyqmakihpepgtweeflekfmagqvsfgpwydhvkswwekr keyrilylfyedmkenpkceiqkilkflekdipeeilnkilyhssfsvmkenpsanyttm mkeemdhsvspfmrkgisgdwknqftvaqyekfeedyvkkmedstlkfrse
Timeline for d2zytx_: