Lineage for d2zxwu_ (2zxw U:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916435Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 916436Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 916437Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 916454Protein automated matches [190271] (1 species)
    not a true protein
  7. 916455Species Cow (Bos taurus) [TaxId:9913] [187063] (16 PDB entries)
  8. 916483Domain d2zxwu_: 2zxw U: [171590]
    Other proteins in same PDB: d2zxwa_, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
    automated match to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwu_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (U:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2zxwu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOPe Domain Coordinates for d2zxwu_:

Click to download the PDB-style file with coordinates for d2zxwu_.
(The format of our PDB-style files is described here.)

Timeline for d2zxwu_: