Lineage for d2zxwt_ (2zxw T:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059440Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 1059441Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1059442Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 1059443Species Cow (Bos taurus) [TaxId:9913] [81408] (22 PDB entries)
  8. 1059477Domain d2zxwt_: 2zxw T: [171589]
    Other proteins in same PDB: d2zxwa_, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwt_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (T:) cytochrome c oxidase polypeptide 6a2

SCOPe Domain Sequences for d2zxwt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d2zxwt_:

Click to download the PDB-style file with coordinates for d2zxwt_.
(The format of our PDB-style files is described here.)

Timeline for d2zxwt_: