Lineage for d2zxwr_ (2zxw R:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096546Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 1096547Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 1096548Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 1096549Species Cow (Bos taurus) [TaxId:9913] [48482] (23 PDB entries)
  8. 1096584Domain d2zxwr_: 2zxw R: [171587]
    Other proteins in same PDB: d2zxwa_, d2zxwc_, d2zxwd_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwp_, d2zxwq_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwr_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (R:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d2zxwr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d2zxwr_:

Click to download the PDB-style file with coordinates for d2zxwr_.
(The format of our PDB-style files is described here.)

Timeline for d2zxwr_: