Lineage for d2zxwm_ (2zxw M:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238281Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
  5. 1238282Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 1238299Protein automated matches [190273] (1 species)
    not a true protein
  7. 1238300Species Cow (Bos taurus) [TaxId:9913] [187065] (16 PDB entries)
  8. 1238326Domain d2zxwm_: 2zxw M: [171583]
    Other proteins in same PDB: d2zxwa_, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwn_, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_
    automated match to d1occm_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwm_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (M:) cytochrome c oxidase polypeptide 8h

SCOPe Domain Sequences for d2zxwm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwm_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d2zxwm_:

Click to download the PDB-style file with coordinates for d2zxwm_.
(The format of our PDB-style files is described here.)

Timeline for d2zxwm_: