SCOPe 2.06: Domain d2zxwf_: 2zxw F:

Lineage for d2zxwf_ (2zxw F:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (35 PDB entries)

8. Domain d2zxwf_: 2zxw F: [171576]
   Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwb2, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwo2, d2zxwp_, d2zxwq_, d2zxwr_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
   automated match to d1occf_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwf_

PDB Entry: 2zxw, 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)

PDB Compounds: (F:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d2zxwf_:

Sequence; same for both SEQRES and ATOM records:

>d2zxwf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
ednstviwfwlhkgeaqrcpscgthyklvphql

Timeline for d2zxwf_:

• d2zxwf_ first appeared in SCOPe 2.01
  
• d2zxwf_ appears in SCOPe 2.05
  
• d2zxwf_ appears in SCOPe 2.07
  
• d2zxwf_ appears in the current release, SCOPe 2.08