Lineage for d2zxwe_ (2zxw E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340249Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2340250Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2340251Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2340252Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries)
  8. 2340314Domain d2zxwe_: 2zxw E: [171575]
    Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwb2, d2zxwc_, d2zxwd_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwo2, d2zxwp_, d2zxwq_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwe_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (E:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d2zxwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d2zxwe_:

Click to download the PDB-style file with coordinates for d2zxwe_.
(The format of our PDB-style files is described here.)

Timeline for d2zxwe_: