Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (23 PDB entries) |
Domain d2zxwc_: 2zxw C: [171573] Other proteins in same PDB: d2zxwa_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_ automated match to d1occc_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 2zxw (more details), 2.5 Å
SCOPe Domain Sequences for d2zxwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxwc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d2zxwc_: