SCOPe 2.02: Domain d2zwma_: 2zwm A:

Lineage for d2zwma_ (2zwm A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (7 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189041] (1 PDB entry)

8. Domain d2zwma_: 2zwm A: [171563]
   automated match to d1nxoa_
   complexed with so4

Details for d2zwma_

PDB Entry: 2zwm, 2.04 Å

PDB Description: Crystal structure of YycF receiver domain from Bacillus subtilis

PDB Compounds: (A:) Transcriptional regulatory protein yycF

SCOPe Domain Sequences for d2zwma_:

Sequence; same for both SEQRES and ATOM records:

>d2zwma_ c.23.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
dkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkdg
vevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrql

Timeline for d2zwma_:

• d2zwma_ first appeared in SCOPe 2.01
  
• d2zwma_ appears in SCOPe 2.03
  
• d2zwma_ appears in the current release, SCOPe 2.08