Lineage for d2zvpx_ (2zvp X:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987542Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 987619Protein automated matches [190189] (4 species)
    not a true protein
  7. 987638Species Mouse (Mus musculus) [TaxId:10090] [188670] (7 PDB entries)
  8. 987641Domain d2zvpx_: 2zvp X: [171547]
    automated match to d1ls6a_
    complexed with a3p, gol, npo

Details for d2zvpx_

PDB Entry: 2zvp (more details), 1.3 Å

PDB Description: Crystal structure of mouse cytosolic sulfotransferase mSULT1D1 complex with PAP and p-nitrophenol
PDB Compounds: (X:) Tyrosine-ester sulfotransferase

SCOPe Domain Sequences for d2zvpx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zvpx_ c.37.1.5 (X:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ldvfrrelvdvegiplfwsiaehwsqvesfearpddilistypksgttwvseildliynn
gdaekckrdaiykrvpfmeliipgitngvemlnnmpsprivkthlpvqllpssfwkndck
iiyvarnakdvvvsyyyfyqmakihpepgtweeflekfmagqvsfgpwydhvkswwekrk
eyrilylfyedmkenpkceiqkilkflekdipeeilnkilyhssfsvmkenpsanyttmm
keemdhsvspfmrkgisgdwknqftvaqyekfeedyvkkmedstlkfrs

SCOPe Domain Coordinates for d2zvpx_:

Click to download the PDB-style file with coordinates for d2zvpx_.
(The format of our PDB-style files is described here.)

Timeline for d2zvpx_: