Lineage for d2zu2a_ (2zu2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797364Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2797365Species Human coronavirus 229E [TaxId:11137] [89348] (2 PDB entries)
  8. 2797366Domain d2zu2a_: 2zu2 A: [171525]
    automated match to d1p9sa_
    complexed with dtz, mpd

    has additional subdomain(s) that are not in the common domain

Details for d2zu2a_

PDB Entry: 2zu2 (more details), 1.8 Å

PDB Description: complex structure of CoV 229E 3CL protease with EPDTC
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d2zu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zu2a_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]}
aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim
rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc
aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm
yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta
mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn

SCOPe Domain Coordinates for d2zu2a_:

Click to download the PDB-style file with coordinates for d2zu2a_.
(The format of our PDB-style files is described here.)

Timeline for d2zu2a_: