Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species) contains an extra alpha-helical domain |
Species Human coronavirus 229E [TaxId:11137] [89348] (2 PDB entries) |
Domain d2zu2a_: 2zu2 A: [171525] automated match to d1p9sa_ complexed with dtz, mpd has additional subdomain(s) that are not in the common domain |
PDB Entry: 2zu2 (more details), 1.8 Å
SCOPe Domain Sequences for d2zu2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zu2a_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]} aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn
Timeline for d2zu2a_: