SCOPe 2.08: Domain d2ztza_: 2ztz A:

Lineage for d2ztza_ (2ztz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Human coxsackievirus B3 [TaxId:12072] [188738] (7 PDB entries)

8. Domain d2ztza_: 2ztz A: [171521]
   automated match to d1l1na_

Details for d2ztza_

PDB Entry: 2ztz, 2 Å

PDB Description: crystal structure of 3C protease from CVB3 in space group P21

PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d2ztza_:

Sequence; same for both SEQRES and ATOM records:

>d2ztza_ b.47.1.4 (A:) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

Timeline for d2ztza_:

• d2ztza_ first appeared in SCOPe 2.01
  
• d2ztza_ appears in SCOPe 2.07