SCOPe 2.03: Domain d2zswh_: 2zsw H:

Lineage for d2zswh_ (2zsw H:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
   Uniprot P01887

8. Domain d2zswh_: 2zsw H: [171492]
   automated match to d1biib_

Details for d2zswh_

PDB Entry: 2zsw, 2.8 Å

PDB Description: Crystal structure of H-2Kb in complex with the Q600Y variant of JHMV epitope S598

PDB Compounds: (H:) Beta-2-microglobulin

SCOPe Domain Sequences for d2zswh_:

Sequence; same for both SEQRES and ATOM records:

>d2zswh_ b.1.1.2 (H:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2zswh_:

• d2zswh_ first appeared in SCOPe 2.01
  
• d2zswh_ appears in SCOPe 2.02
  
• d2zswh_ appears in SCOPe 2.04
  
• d2zswh_ appears in the current release, SCOPe 2.08