Lineage for d2zswd_ (2zsw D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932530Domain d2zswd_: 2zsw D: [171490]
    automated match to d1biib_

Details for d2zswd_

PDB Entry: 2zsw (more details), 2.8 Å

PDB Description: Crystal structure of H-2Kb in complex with the Q600Y variant of JHMV epitope S598
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d2zswd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zswd_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d2zswd_:

Click to download the PDB-style file with coordinates for d2zswd_.
(The format of our PDB-style files is described here.)

Timeline for d2zswd_: