Lineage for d2zsvd_ (2zsv D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1513477Protein beta2-microglobulin [88600] (5 species)
  7. 1514079Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries)
    Uniprot P01887
  8. 1514098Domain d2zsvd_: 2zsv D: [171488]
    automated match to d1biib_
    complexed with cys, gol

Details for d2zsvd_

PDB Entry: 2zsv (more details), 1.8 Å

PDB Description: Crystal structure of H-2Kb in complex with JHMV epitope S598
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d2zsvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zsvd_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d2zsvd_:

Click to download the PDB-style file with coordinates for d2zsvd_.
(The format of our PDB-style files is described here.)

Timeline for d2zsvd_: