Lineage for d2zsja_ (2zsj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907822Species Aquifex aeolicus [TaxId:63363] [188641] (1 PDB entry)
  8. 2907823Domain d2zsja_: 2zsj A: [171466]
    automated match to d1uima_
    complexed with plp

Details for d2zsja_

PDB Entry: 2zsj (more details), 1.8 Å

PDB Description: Crystal structure of threonine synthase from Aquifex aeolicus VF5
PDB Compounds: (A:) threonine synthase

SCOPe Domain Sequences for d2zsja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zsja_ c.79.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
rwqgiikqykkylpvdentpivtlyegntplieadnlaraigfkgkiylkyeglnptgsf
kdrgmtlaiskaveagkravicastgntsasaaayaaraglrayvllpkgavaigklsqa
miygakvlaiqgtfddalnivrkigenfpveivnsvnpyriegqktaafeicdtlgeapd
yhfipvgnagnitaywkgfkiyyeegkitklprmmgwqaegaapivkgypiknpqtiata
ikignpyswksalkaaqesggkidavsdseilyaykliastegvfcepasaasvaglikl
vregffkggevvtctltgnglkdpdtaikvceepitvppdfdevvkvlgf

SCOPe Domain Coordinates for d2zsja_:

Click to download the PDB-style file with coordinates for d2zsja_.
(The format of our PDB-style files is described here.)

Timeline for d2zsja_: