Lineage for d2zsea_ (2zse A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366436Species Mycobacterium tuberculosis [TaxId:1773] [189039] (12 PDB entries)
  8. 1366441Domain d2zsea_: 2zse A: [171464]
    automated match to d1esma_
    complexed with acp, edo, flc, gol, na, pau

Details for d2zsea_

PDB Entry: 2zse (more details), 2.5 Å

PDB Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with AMPPCP and Pantothenate
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d2zsea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zsea_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

SCOPe Domain Coordinates for d2zsea_:

Click to download the PDB-style file with coordinates for d2zsea_.
(The format of our PDB-style files is described here.)

Timeline for d2zsea_: