Lineage for d2zsca_ (2zsc A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325518Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 1325519Protein automated matches [190537] (7 species)
    not a true protein
  7. 1325558Species Pleurotus cornucopiae [TaxId:5321] [188786] (1 PDB entry)
  8. 1325559Domain d2zsca_: 2zsc A: [171461]
    automated match to d1hy2a_
    complexed with btn, gol, mg

Details for d2zsca_

PDB Entry: 2zsc (more details), 1.3 Å

PDB Description: Tamavidin2, Novel Avidin-like Biotin-Binding Proteins from an Edible Mushroom
PDB Compounds: (A:) Tamavidin2

SCOPe Domain Sequences for d2zsca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zsca_ b.61.1.0 (A:) automated matches {Pleurotus cornucopiae [TaxId: 5321]}
sdvqssltgtwynelnskmeltankdgtltgkylskvgdvyvpyplsgrynlqppagqgv
algwavswenskihsattwsgqffsesspviltqwllssstargdvwestlvgndsftkt
apt

SCOPe Domain Coordinates for d2zsca_:

Click to download the PDB-style file with coordinates for d2zsca_.
(The format of our PDB-style files is described here.)

Timeline for d2zsca_: