Lineage for d2zsba_ (2zsb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872599Species Mycobacterium tuberculosis [TaxId:1773] [189039] (16 PDB entries)
  8. 2872617Domain d2zsba_: 2zsb A: [171460]
    automated match to d1esma_
    complexed with adp, gol

Details for d2zsba_

PDB Entry: 2zsb (more details), 2.75 Å

PDB Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with ADP, obtained through soaking of native enzyme crystals with the ligand
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d2zsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zsba_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

SCOPe Domain Coordinates for d2zsba_:

Click to download the PDB-style file with coordinates for d2zsba_.
(The format of our PDB-style files is described here.)

Timeline for d2zsba_: