Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (12 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189037] (2 PDB entries) |
Domain d2zqxa_: 2zqx A: [171442] automated match to d1izoa_ complexed with hem |
PDB Entry: 2zqx (more details), 2.37 Å
SCOPe Domain Sequences for d2zqxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqxa_ a.104.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk
Timeline for d2zqxa_: