Lineage for d2zpua_ (2zpu A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1874686Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1874687Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1874688Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1874920Protein automated matches [190054] (10 species)
    not a true protein
  7. 1874932Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188093] (3 PDB entries)
  8. 1874933Domain d2zpua_: 2zpu A: [171411]
    automated match to d1v71a1
    complexed with mg, pdd

Details for d2zpua_

PDB Entry: 2zpu (more details), 1.7 Å

PDB Description: crystal structure of modified serine racemase from s.pombe.
PDB Compounds: (A:) Uncharacterized protein C320.14

SCOPe Domain Sequences for d2zpua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpua_ c.79.1.1 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
lvlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrgalna
lsqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyggqvi
mydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfvclgg
ggllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtqhlgn
ytfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklknkrig
iiisggnvdieryahflsq

SCOPe Domain Coordinates for d2zpua_:

Click to download the PDB-style file with coordinates for d2zpua_.
(The format of our PDB-style files is described here.)

Timeline for d2zpua_: