Lineage for d2zptx_ (2zpt X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866454Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2866543Protein automated matches [190189] (4 species)
    not a true protein
  7. 2866570Species Mouse (Mus musculus) [TaxId:10090] [188670] (8 PDB entries)
  8. 2866571Domain d2zptx_: 2zpt X: [171410]
    automated match to d1ls6a_
    complexed with a3p, gol

Details for d2zptx_

PDB Entry: 2zpt (more details), 1.15 Å

PDB Description: Crystal structure of mouse sulfotransferase SULT1D1 complex with PAP
PDB Compounds: (X:) Tyrosine-ester sulfotransferase

SCOPe Domain Sequences for d2zptx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zptx_ c.37.1.5 (X:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvfrrelvdvegiplfwsiaehwsqvesfearpddilistypksgttwvseildliynng
daekckrdaiykrvpfmeliipgitngvemlnnmpsprivkthlpvqllpssfwkndcki
iyvarnakdvvvsyyyfyqmakihpepgtweeflekfmagqvsfgpwydhvkswwekrke
yrilylfyedmkenpkceiqkilkflekdipeeilnkilyhssfsvmkenpsanyttmmk
eemdhsvspfmrkgisgdwknqftvaqyekfeedyvkkmedstlkfrs

SCOPe Domain Coordinates for d2zptx_:

Click to download the PDB-style file with coordinates for d2zptx_.
(The format of our PDB-style files is described here.)

Timeline for d2zptx_: