Lineage for d2zkca1 (2zkc A:232-457)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2012943Domain d2zkca1: 2zkc A:232-457 [171281]
    automated match to d1tfca_
    protein/DNA complex; complexed with bpz, gol

Details for d2zkca1

PDB Entry: 2zkc (more details), 1.7 Å

PDB Description: Crystal structure of human estrogen-related receptor gamma ligand binding domain complex with bisphenol Z
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d2zkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkca1 a.123.1.1 (A:232-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfst
lsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailq
lvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedp
rragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleak

SCOPe Domain Coordinates for d2zkca1:

Click to download the PDB-style file with coordinates for d2zkca1.
(The format of our PDB-style files is described here.)

Timeline for d2zkca1: