Class g: Small proteins [56992] (90 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
Protein automated matches [190046] (3 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [186767] (11 PDB entries) |
Domain d2zjxb_: 2zjx B: [171264] automated match to d7ptia_ complexed with so4 |
PDB Entry: 2zjx (more details), 1.09 Å
SCOPe Domain Sequences for d2zjxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjxb_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} rpdfcleppytgpgkariiryfynakaglaqtfvyggarakrnnfksaedalrtcgg
Timeline for d2zjxb_: