SCOPe 2.03: Domain d2zjxb_: 2zjx B:

Lineage for d2zjxb_ (2zjx B:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186767] (11 PDB entries)

8. Domain d2zjxb_: 2zjx B: [171264]
   automated match to d7ptia_
   complexed with so4

Details for d2zjxb_

PDB Entry: 2zjx, 1.09 Å

PDB Description: bovine pancreatic trypsin inhibitor (bpti) containing only the [5,55] disulfide bond

PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d2zjxb_:

Sequence; same for both SEQRES and ATOM records:

>d2zjxb_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpgkariiryfynakaglaqtfvyggarakrnnfksaedalrtcgg

Timeline for d2zjxb_:

• d2zjxb_ first appeared in SCOPe 2.01
  
• d2zjxb_ appears in SCOPe 2.02
  
• d2zjxb_ appears in SCOPe 2.04
  
• d2zjxb_ appears in the current release, SCOPe 2.08