Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d2zjvd1: 2zjv D:2-207 [171260] Other proteins in same PDB: d2zjva2, d2zjvb2, d2zjvc2, d2zjvd2, d2zjve2 automated match to d1uw6a_ complexed with ct4 |
PDB Entry: 2zjv (more details), 2.7 Å
SCOPe Domain Sequences for d2zjvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjvd1 b.96.1.1 (D:2-207) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn svtysccpeayedvevslnfrkkgrs
Timeline for d2zjvd1: