Lineage for d2zjvd1 (2zjv D:2-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819577Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)
  8. 2819770Domain d2zjvd1: 2zjv D:2-207 [171260]
    Other proteins in same PDB: d2zjva2, d2zjvb2, d2zjvc2, d2zjvd2, d2zjve2
    automated match to d1uw6a_
    complexed with ct4

Details for d2zjvd1

PDB Entry: 2zjv (more details), 2.7 Å

PDB Description: crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) complexed with clothianidin
PDB Compounds: (D:) acetylcholine-binding protein

SCOPe Domain Sequences for d2zjvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjvd1 b.96.1.1 (D:2-207) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkgrs

SCOPe Domain Coordinates for d2zjvd1:

Click to download the PDB-style file with coordinates for d2zjvd1.
(The format of our PDB-style files is described here.)

Timeline for d2zjvd1: