Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (23 species) not a true protein |
Species Escherichia coli [TaxId:562] [187306] (66 PDB entries) |
Domain d2zj9a_: 2zj9 A: [171241] automated match to d1c3ba_ complexed with ipa, na |
PDB Entry: 2zj9 (more details), 1.7 Å
SCOPe Domain Sequences for d2zj9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zj9a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamktrvfqplk lnhtwinvpsaeeknyawgyregkavhvspraldaeaygvkstiedmarwvqsnlkpldi nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiiinnkialaarpvkpitpptp avraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq
Timeline for d2zj9a_: