Lineage for d2zj9a_ (2zj9 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950053Species Escherichia coli [TaxId:562] [187306] (55 PDB entries)
  8. 1950119Domain d2zj9a_: 2zj9 A: [171241]
    automated match to d1c3ba_
    complexed with ipa, na

Details for d2zj9a_

PDB Entry: 2zj9 (more details), 1.7 Å

PDB Description: X-ray crystal structure of AmpC beta-Lactamase (AmpC(D)) from an Escherichia coli with a Tripeptide Deletion (Gly286 Ser287 Asp288) on the H10 Helix
PDB Compounds: (A:) AmpC

SCOPe Domain Sequences for d2zj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zj9a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamktrvfqplk
lnhtwinvpsaeeknyawgyregkavhvspraldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiiinnkialaarpvkpitpptp
avraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

SCOPe Domain Coordinates for d2zj9a_:

Click to download the PDB-style file with coordinates for d2zj9a_.
(The format of our PDB-style files is described here.)

Timeline for d2zj9a_: