Lineage for d2ziba1 (2zib A:7-133)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607754Species Brachyopsis rostratus [TaxId:412977] [188571] (1 PDB entry)
  8. 2607755Domain d2ziba1: 2zib A:7-133 [171237]
    Other proteins in same PDB: d2ziba2
    automated match to d2afpa_
    complexed with so4

Details for d2ziba1

PDB Entry: 2zib (more details), 1.34 Å

PDB Description: Crystal structure analysis of calcium-independent type II antifreeze protein
PDB Compounds: (A:) Type II antifreeze protein

SCOPe Domain Sequences for d2ziba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ziba1 d.169.1.1 (A:7-133) automated matches {Brachyopsis rostratus [TaxId: 412977]}
alvcpagwtlhgqrcfyseatamtwdlaeancvnkgghlasihsleeqlyikdivagivw
iggsackvagawswtdgtpvdyrtwcptkpndilsdccmqmtaavdkcwddlpcpashas
icakaai

SCOPe Domain Coordinates for d2ziba1:

Click to download the PDB-style file with coordinates for d2ziba1.
(The format of our PDB-style files is described here.)

Timeline for d2ziba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ziba2