Lineage for d2ziba_ (2zib A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1941004Protein automated matches [190329] (8 species)
    not a true protein
  7. 1941010Species Brachyopsis rostratus [TaxId:412977] [188571] (1 PDB entry)
  8. 1941011Domain d2ziba_: 2zib A: [171237]
    automated match to d2afpa_
    complexed with so4

Details for d2ziba_

PDB Entry: 2zib (more details), 1.34 Å

PDB Description: Crystal structure analysis of calcium-independent type II antifreeze protein
PDB Compounds: (A:) Type II antifreeze protein

SCOPe Domain Sequences for d2ziba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ziba_ d.169.1.1 (A:) automated matches {Brachyopsis rostratus [TaxId: 412977]}
hhhalvcpagwtlhgqrcfyseatamtwdlaeancvnkgghlasihsleeqlyikdivag
ivwiggsackvagawswtdgtpvdyrtwcptkpndilsdccmqmtaavdkcwddlpcpas
hasicakaai

SCOPe Domain Coordinates for d2ziba_:

Click to download the PDB-style file with coordinates for d2ziba_.
(The format of our PDB-style files is described here.)

Timeline for d2ziba_: