SCOPe 2.05: Domain d2zfod_: 2zfo D:

Lineage for d2zfod_ (2zfo D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (18 species)
   not a true protein

7. Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)

8. Domain d2zfod_: 2zfo D: [171197]
   automated match to d1x9fa_
   complexed with gol, hem, oxy

Details for d2zfod_

PDB Entry: 2zfo, 1.95 Å

PDB Description: Structure of the partially unliganded met state of 400 kDa hemoglobin: Insights into ligand-induced structural changes of giant hemoglobins

PDB Compounds: (D:) Extracellular giant hemoglobin major globin subunit B1

SCOPe Domain Sequences for d2zfod_:

Sequence; same for both SEQRES and ATOM records:

>d2zfod_ a.1.1.0 (D:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
eccsrgdaevvisewdqvfnaamagssesaigvaifdvfftssgvspsmfpgggdsssae
flaqvsrvisgadiainsltnratcdsllshlnaqhkaisgvtgaavthlseaissvvaq
vlpsahidawgycmayiaagigagl

Timeline for d2zfod_:

• d2zfod_ first appeared in SCOPe 2.01
  
• d2zfod_ appears in SCOPe 2.04
  
• d2zfod_ appears in SCOPe 2.06
  
• d2zfod_ appears in the current release, SCOPe 2.08