Lineage for d2zfoc_ (2zfo C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718504Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1718505Protein automated matches [190590] (18 species)
    not a true protein
  7. 1718596Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)
  8. 1718607Domain d2zfoc_: 2zfo C: [171196]
    automated match to d1x9fa_
    complexed with gol, hem, oxy

Details for d2zfoc_

PDB Entry: 2zfo (more details), 1.95 Å

PDB Description: Structure of the partially unliganded met state of 400 kDa hemoglobin: Insights into ligand-induced structural changes of giant hemoglobins
PDB Compounds: (C:) Extracellular giant hemoglobin major globin subunit B2

SCOPe Domain Sequences for d2zfoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfoc_ a.1.1.0 (C:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
ssccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpds
adfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevm
pqvsscfssdswnrcfariangisagl

SCOPe Domain Coordinates for d2zfoc_:

Click to download the PDB-style file with coordinates for d2zfoc_.
(The format of our PDB-style files is described here.)

Timeline for d2zfoc_: