SCOPe 2.06: Domain d2zfob_: 2zfo B:

Lineage for d2zfob_ (2zfo B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (21 species)
   not a true protein

7. Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)

8. Domain d2zfob_: 2zfo B: [171195]
   automated match to d1x9fb_
   complexed with gol, hem, oxy

Details for d2zfob_

PDB Entry: 2zfo, 1.95 Å

PDB Description: Structure of the partially unliganded met state of 400 kDa hemoglobin: Insights into ligand-induced structural changes of giant hemoglobins

PDB Compounds: (B:) Extracellular giant hemoglobin major globin subunit A2

SCOPe Domain Sequences for d2zfob_:

Sequence; same for both SEQRES and ATOM records:

>d2zfob_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
arsfdndawnscmnqivsgisg

Timeline for d2zfob_:

• d2zfob_ first appeared in SCOPe 2.01
  
• d2zfob_ appears in SCOPe 2.05
  
• d2zfob_ appears in SCOPe 2.07
  
• d2zfob_ appears in the current release, SCOPe 2.08