Lineage for d2zfea_ (2zfe A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576670Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2576671Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2576672Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 2576831Protein automated matches [190122] (7 species)
    not a true protein
  7. 2576832Species Halobacterium salinarium [TaxId:2242] [188662] (3 PDB entries)
  8. 2576835Domain d2zfea_: 2zfe A: [171193]
    automated match to d1cwqa_
    complexed with l1p, l2p, l3p, ret, xe

Details for d2zfea_

PDB Entry: 2zfe (more details), 2.5 Å

PDB Description: Crystal structure of bacteriorhodopsin-xenon complex
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d2zfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfea_ f.13.1.1 (A:) automated matches {Halobacterium salinarium [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

SCOPe Domain Coordinates for d2zfea_:

Click to download the PDB-style file with coordinates for d2zfea_.
(The format of our PDB-style files is described here.)

Timeline for d2zfea_: