Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) |
Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species) |
Species Escherichia coli [TaxId:562] [47444] (2 PDB entries) |
Domain d1uxca_: 1uxc A: [17119] mutant |
PDB Entry: 1uxc (more details)
SCOP Domain Sequences for d1uxca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxca_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpn
Timeline for d1uxca_: