Lineage for d1uxca_ (1uxc A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768184Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 768185Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species)
  7. 768186Species Escherichia coli [TaxId:562] [47444] (2 PDB entries)
  8. 768188Domain d1uxca_: 1uxc A: [17119]
    mutant

Details for d1uxca_

PDB Entry: 1uxc (more details)

PDB Description: fructose repressor dna-binding domain, nmr, minimized structure
PDB Compounds: (A:) fructose repressor

SCOP Domain Sequences for d1uxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxca_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpn

SCOP Domain Coordinates for d1uxca_:

Click to download the PDB-style file with coordinates for d1uxca_.
(The format of our PDB-style files is described here.)

Timeline for d1uxca_: