Lineage for d2zchp_ (2zch P:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066187Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)
  8. 2066340Domain d2zchp_: 2zch P: [171155]
    Other proteins in same PDB: d2zchl1, d2zchl2
    automated match to d1gvza_
    complexed with cl, ndg, po4

Details for d2zchp_

PDB Entry: 2zch (more details), 2.83 Å

PDB Description: crystal structure of human prostate specific antigen complexed with an activating antibody
PDB Compounds: (P:) Prostate-specific antigen

SCOPe Domain Sequences for d2zchp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zchp_ b.47.1.2 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggwecekhsqpwqvlvasrgravcggvlvhpqwvltaahcirnksvillgrhslfhpe
dtgqvfqvshsfphplydmsllknrflrpgddsshdlmllrlsepaeltdavkvmdlptq
epalgttcyasgwgsiepeefltpkklqcvdlhvisndvcaqvhpqkvtkfmlcagrwtg
gkstcsgdsggplvcngvlqgitswgsepcalperpslytkvvhyrkwikdtivanp

SCOPe Domain Coordinates for d2zchp_:

Click to download the PDB-style file with coordinates for d2zchp_.
(The format of our PDB-style files is described here.)

Timeline for d2zchp_: