SCOP 1.73: Domain d1lbga1: 1lbg A:1-60

Lineage for d1lbga1 (1lbg A:1-60)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (10 PDB entries)

8. Domain d1lbga1: 1lbg A:1-60 [17114]
   Other proteins in same PDB: d1lbga2, d1lbgb2, d1lbgc2, d1lbgd2

Details for d1lbga1

PDB Entry: 1lbg, 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

PDB Compounds: (A:) protein (lactose operon repressor)

SCOP Domain Sequences for d1lbga1:

Sequence; same for both SEQRES and ATOM records:

>d1lbga1 a.35.1.5 (A:1-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

Timeline for d1lbga1:

• d1lbga1 first appeared (with stable ids) in SCOP 1.55
  
• d1lbga1 appears in SCOP 1.71
  
• d1lbga1 appears in SCOP 1.75
  
• d1lbga1 appears in the current release, SCOPe 2.08