Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein automated matches [190113] (11 species) not a true protein |
Species Hizikia fusiformis [TaxId:74103] [188620] (1 PDB entry) |
Domain d2zboa_: 2zbo A: [171136] automated match to d1gdva_ complexed with hem, so4 |
PDB Entry: 2zbo (more details), 1.6 Å
SCOPe Domain Sequences for d2zboa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zboa_ a.3.1.1 (A:) automated matches {Hizikia fusiformis [TaxId: 74103]} adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa fggrlsdddiedvasfvlsqsekswn
Timeline for d2zboa_: