Lineage for d1lcda_ (1lcd A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3087Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 3092Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 3093Species Escherichia coli [TaxId:562] [47442] (6 PDB entries)
  8. 3099Domain d1lcda_: 1lcd A: [17111]

Details for d1lcda_

PDB Entry: 1lcd (more details)

PDB Description: structure of the complex of lac repressor headpiece and an 11 base- pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics

SCOP Domain Sequences for d1lcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcda_ a.35.1.5 (A:) Lac repressor (LacR), N-terminal domain {Escherichia coli}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnr

SCOP Domain Coordinates for d1lcda_:

Click to download the PDB-style file with coordinates for d1lcda_.
(The format of our PDB-style files is described here.)

Timeline for d1lcda_: