SCOPe 2.01: Domain d2z8wc_: 2z8w C:

Lineage for d2z8wc_ (2z8w C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (5 PDB entries)

8. Domain d2z8wc_: 2z8w C: [171108]
   automated match to d1vesa_

Details for d2z8wc_

PDB Entry: 2z8w, 2.45 Å

PDB Description: structure of an ignar-ama1 complex

PDB Compounds: (C:) new antigen receptor variable domain

SCOPe Domain Sequences for d2z8wc_:

Sequence; same for both SEQRES and ATOM records:

>d2z8wc_ b.1.1.1 (C:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
kgsksfslrisdlrvedsgtykcqafyslllrdynysllfrgekgagtaltvkaaa

Timeline for d2z8wc_:

• d2z8wc_ is new in SCOPe 2.01-stable
  
• d2z8wc_ appears in SCOPe 2.02
  
• d2z8wc_ appears in the current release, SCOPe 2.08, called d2z8wc1