Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
Protein Lac repressor (LacR), N-terminal domain [47441] (1 species) |
Species Escherichia coli [TaxId:562] [47442] (14 PDB entries) |
Domain d1lqca_: 1lqc A: [17109] |
PDB Entry: 1lqc (more details)
SCOPe Domain Sequences for d1lqca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqca_ a.35.1.5 (A:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqql
Timeline for d1lqca_: