SCOPe 2.08: Domain d2z39b_: 2z39 B:

Lineage for d2z39b_ (2z39 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
   automatically mapped to Pfam PF00182

6. Protein automated matches [190455] (7 species)
   not a true protein

7. Species Brassica juncea [TaxId:3707] [187370] (3 PDB entries)

8. Domain d2z39b_: 2z39 B: [171026]
   Other proteins in same PDB: d2z39a2
   automated match to d2baaa_
   complexed with cl; mutant

Details for d2z39b_

PDB Entry: 2z39, 1.7 Å

PDB Description: crystal structure of brassica juncea chitinase catalytic module glu234ala mutant (bjchi3-e234a)

PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d2z39b_:

Sequence; same for both SEQRES and ATOM records:

>d2z39b_ d.2.1.1 (B:) automated matches {Brassica juncea [TaxId: 3707]}
dlsgiisrdqfykmlkhmndndchavgfftydafitaaksfpsfgntgdlamrkkeiaaf
fgqtshettggwsgapdgantwgycykeaidksdphcdsnnlewpcapgkfyygrgpmml
swnynygpcgrdlglellknpdvassdpviafktaiwfwmtpqapkpschdvitdqweps
aadisagrlpgygvitniingglecagrdvakvqdrisfytrycgmfgvdpgsnidcdnq
rpfn

Timeline for d2z39b_:

• d2z39b_ first appeared in SCOPe 2.01
  
• d2z39b_ appears in SCOPe 2.07