Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins) automatically mapped to Pfam PF00182 |
Protein automated matches [190455] (7 species) not a true protein |
Species Brassica juncea [TaxId:3707] [187370] (3 PDB entries) |
Domain d2z39b_: 2z39 B: [171026] Other proteins in same PDB: d2z39a2 automated match to d2baaa_ complexed with cl; mutant |
PDB Entry: 2z39 (more details), 1.7 Å
SCOPe Domain Sequences for d2z39b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z39b_ d.2.1.1 (B:) automated matches {Brassica juncea [TaxId: 3707]} dlsgiisrdqfykmlkhmndndchavgfftydafitaaksfpsfgntgdlamrkkeiaaf fgqtshettggwsgapdgantwgycykeaidksdphcdsnnlewpcapgkfyygrgpmml swnynygpcgrdlglellknpdvassdpviafktaiwfwmtpqapkpschdvitdqweps aadisagrlpgygvitniingglecagrdvakvqdrisfytrycgmfgvdpgsnidcdnq rpfn
Timeline for d2z39b_: