Lineage for d2z38a_ (2z38 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632228Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 1632236Protein automated matches [190455] (6 species)
    not a true protein
  7. 1632237Species Brassica juncea [TaxId:3707] [187370] (3 PDB entries)
  8. 1632244Domain d2z38a_: 2z38 A: [171024]
    automated match to d2baaa_
    complexed with cl

Details for d2z38a_

PDB Entry: 2z38 (more details), 1.8 Å

PDB Description: crystal structure of chloride bound brassica juncea chitinase catalytic module (bjchi3)
PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d2z38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z38a_ d.2.1.1 (A:) automated matches {Brassica juncea [TaxId: 3707]}
efgdlsgiisrdqfykmlkhmndndchavgfftydafitaaksfpsfgntgdlamrkkei
aaffgqtshettggwsgapdgantwgycykeeidksdphcdsnnlewpcapgkfyygrgp
mmlswnynygpcgrdlglellknpdvassdpviafktaiwfwmtpqapkpschdvitdqw
epsaadisagrlpgygvitniingglecagrdvakvqdrisfytrycgmfgvdpgsnidc
dnqrpfn

SCOPe Domain Coordinates for d2z38a_:

Click to download the PDB-style file with coordinates for d2z38a_.
(The format of our PDB-style files is described here.)

Timeline for d2z38a_: