SCOPe 2.04: Domain d2z37c_: 2z37 C:

Lineage for d2z37c_ (2z37 C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
   automatically mapped to Pfam PF00182

6. Protein automated matches [190455] (6 species)
   not a true protein

7. Species Brassica juncea [TaxId:3707] [187370] (3 PDB entries)

8. Domain d2z37c_: 2z37 C: [171022]
   automated match to d2baaa_

Details for d2z37c_

PDB Entry: 2z37, 1.53 Å

PDB Description: crystal structure of brassica juncea chitinase catalytic module (bjchi3)

PDB Compounds: (C:) chitinase

SCOPe Domain Sequences for d2z37c_:

Sequence; same for both SEQRES and ATOM records:

>d2z37c_ d.2.1.1 (C:) automated matches {Brassica juncea [TaxId: 3707]}
dlsgiisrdqfykmlkhmndndchavgfftydafitaaksfpsfgntgdlamrkkeiaaf
fgqtshettggwsgapdgantwgycykeeidksdphcdsnnlewpcapgkfyygrgpmml
swnynygpcgrdlglellknpdvassdpviafktaiwfwmtpqapkpschdvitdqweps
aadisagrlpgygvitniingglecagrdvakvqdrisfytrycgmfgvdpgsnidcdnq
rpfn

Timeline for d2z37c_:

• d2z37c_ first appeared in SCOPe 2.01
  
• d2z37c_ appears in SCOPe 2.03
  
• d2z37c_ appears in SCOPe 2.05
  
• d2z37c_ appears in the current release, SCOPe 2.08