Lineage for d2z35a_ (2z35 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356492Domain d2z35a_: 2z35 A: [171016]
    automated match to d1ac6a_

Details for d2z35a_

PDB Entry: 2z35 (more details), 2.2 Å

PDB Description: Crystal structure of immune receptor
PDB Compounds: (A:) T-cell receptor alpha-chain

SCOPe Domain Sequences for d2z35a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z35a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsvtqtggqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsenygnekitfgagtkltikp

SCOPe Domain Coordinates for d2z35a_:

Click to download the PDB-style file with coordinates for d2z35a_.
(The format of our PDB-style files is described here.)

Timeline for d2z35a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2z35b_