Lineage for d1qqaa1 (1qqa A:3-58)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995687Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1995688Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1995962Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1996009Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 1996010Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 1996027Domain d1qqaa1: 1qqa A:3-58 [17101]
    Other proteins in same PDB: d1qqaa2
    protein/DNA complex; complexed with hpa; mutant

Details for d1qqaa1

PDB Entry: 1qqa (more details), 3 Å

PDB Description: purine repressor mutant-hypoxanthine-palindromic operator complex
PDB Compounds: (A:) protein (purine nucleotide synthesis repressor)

SCOPe Domain Sequences for d1qqaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqaa1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnh

SCOPe Domain Coordinates for d1qqaa1:

Click to download the PDB-style file with coordinates for d1qqaa1.
(The format of our PDB-style files is described here.)

Timeline for d1qqaa1: