Lineage for d1qqba1 (1qqb A:3-58)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3087Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 3106Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 3107Species Escherichia coli [TaxId:562] [47440] (21 PDB entries)
  8. 3122Domain d1qqba1: 1qqb A:3-58 [17099]
    Other proteins in same PDB: d1qqba2

Details for d1qqba1

PDB Entry: 1qqb (more details), 2.7 Å

PDB Description: purine repressor mutant-hypoxanthine-palindromic operator complex

SCOP Domain Sequences for d1qqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqba1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnh

SCOP Domain Coordinates for d1qqba1:

Click to download the PDB-style file with coordinates for d1qqba1.
(The format of our PDB-style files is described here.)

Timeline for d1qqba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqba2