Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (72 species) not a true protein |
Species Paenibacillus polymyxa [TaxId:1406] [187337] (5 PDB entries) |
Domain d2z1sa_: 2z1s A: [170985] automated match to d1uyqa1 complexed with ctt |
PDB Entry: 2z1s (more details), 2.46 Å
SCOPe Domain Sequences for d2z1sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z1sa_ c.1.8.0 (A:) automated matches {Paenibacillus polymyxa [TaxId: 1406]} ntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdvacdhfhhf kedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglipmltlyhw dlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgygtgehap ghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserpedvaaairr dgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflginyytrsii rstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilitengaamrd elvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgyskrfgivhi nyetqertpkqsalwfkqmmakngf
Timeline for d2z1sa_: