SCOPe 2.03: Domain d2z1sa_: 2z1s A:

Lineage for d2z1sa_ (2z1s A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (46 species)
   not a true protein

7. Species Paenibacillus polymyxa [TaxId:1406] [187337] (5 PDB entries)

8. Domain d2z1sa_: 2z1s A: [170985]
   automated match to d1uyqa1
   complexed with ctt

Details for d2z1sa_

PDB Entry: 2z1s, 2.46 Å

PDB Description: beta-glucosidase b from paenibacillus polymyxa complexed with cellotetraose

PDB Compounds: (A:) Beta-glucosidase B

SCOPe Domain Sequences for d2z1sa_:

Sequence; same for both SEQRES and ATOM records:

>d2z1sa_ c.1.8.0 (A:) automated matches {Paenibacillus polymyxa [TaxId: 1406]}
ntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdvacdhfhhf
kedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglipmltlyhw
dlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgygtgehap
ghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserpedvaaairr
dgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflginyytrsii
rstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilitengaamrd
elvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgyskrfgivhi
nyetqertpkqsalwfkqmmakngf

Timeline for d2z1sa_:

• d2z1sa_ first appeared in SCOPe 2.01
  
• d2z1sa_ appears in SCOPe 2.02
  
• d2z1sa_ appears in SCOPe 2.04
  
• d2z1sa_ appears in the current release, SCOPe 2.08