SCOPe 2.02: Domain d2z0tb_: 2z0t B:

Lineage for d2z0tb_ (2z0t B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.6: ProFAR isomerase associated domain [117351] (3 proteins)
   Pfam PF07060; DUF1530

6. Protein automated matches [190883] (1 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [188267] (1 PDB entry)

8. Domain d2z0tb_: 2z0t B: [170958]
   automated match to d1s04a_

Details for d2z0tb_

PDB Entry: 2z0t, 1.8 Å

PDB Description: Crystal structure of hypothetical protein PH0355

PDB Compounds: (B:) Putative uncharacterized protein PH0355

SCOPe Domain Sequences for d2z0tb_:

Sequence; same for both SEQRES and ATOM records:

>d2z0tb_ b.122.1.6 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf
kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepi

Timeline for d2z0tb_:

• d2z0tb_ first appeared in SCOPe 2.01
  
• d2z0tb_ appears in SCOPe 2.03
  
• d2z0tb_ appears in the current release, SCOPe 2.08